PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn336121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TALE
Protein Properties Length: 562aa    MW: 62273 Da    PI: 7.1637
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn336121genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox261.5e-084805181854
                 HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  Achn336121 480 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 518
                 5887779******************************88 PP

2BELL796.4e-26353421372
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 qe+++kk +Ll+ll+eVd++Y+q+ ++++tvis+F+a+++l++ ++++++Al++iS  +++L+++i++ i
  Achn336121 353 QEVEAKKKQLLTLLQEVDEQYNQCLDEIHTVISAFHAATELDP-HIHARFALQTISSLYKSLRERISNEI 421
                 899****************************************.**********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.9E-24281419IPR006563POX domain
PfamPF075264.2E-28287418IPR006563POX domain
PROSITE profilePS5007111.029459522IPR001356Homeobox domain
SMARTSM003896.9E-6462526IPR001356Homeobox domain
CDDcd000861.07E-10462523No hitNo description
SuperFamilySSF466892.47E-15464531IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.4E-26465528IPR009057Homeodomain-like
PfamPF059208.9E-15479518IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MAENDAFNVP TDVANRNAIF MDGLFAHVTS ISPARPNSLN LNNQYHIMGE FPALSMLQGE  60
PTKNLHTGFP ISNHAGLIDC GTSAPSEPLV RNAQERFVGG TPISASSIAA ILAAQCGPRD  120
NMNELPSSTP SANPLEISKN PVLNDYPVAL NSAFTTSVNC GYDGLPGGIN NKWVLDKFLA  180
CPEVTEVPGI TGFQPCQLVG NVSVNANGWT SLDNANLSSD NRSSSSKFSN ELSLSLATSC  240
QPSIIRGTNT TDQCSEISCS GVTSSCNSKK LSLGIGSHGS VQISQFLSGS RYLLVIQEIL  300
TEIASYSLEN LDLMNYPASR NARFSLSSSG YALMGSEGDG RCGAQTDPVL REQEVEAKKK  360
QLLTLLQEVD EQYNQCLDEI HTVISAFHAA TELDPHIHAR FALQTISSLY KSLRERISNE  420
ILKMGGFFNR GDNWEEERSF ETSFIQKQWA LQQLRRKDHQ LWRPQRGLPE RSVSVLRAWM  480
FQNFLHPYPK DAEKHLLAVK SGLTRSQVSN WFINARVRLW KPMIEEMYAE MNRRKGRRNV  540
EETENNHRSQ VSINHRRFNK K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14468526563Homeobox protein Meis2
3k2a_B1e-14468526563Homeobox protein Meis2
4xrs_A8e-15468525158Homeobox protein Meis1
4xrs_B8e-15468525158Homeobox protein Meis1
5bng_A8e-15468526159Homeobox protein Meis2
5bng_B8e-15468526159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002278796.30.0PREDICTED: homeobox protein ATH1
RefseqXP_010648330.10.0PREDICTED: homeobox protein ATH1
RefseqXP_010648331.10.0PREDICTED: homeobox protein ATH1
RefseqXP_010648332.10.0PREDICTED: homeobox protein ATH1
SwissprotP487311e-107ATH1_ARATH; Homeobox protein ATH1
TrEMBLF6H3950.0F6H395_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g00880.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-106homeobox gene 1